Gene Bio Systems
Recombinant Saccharomyces cerevisiae Protein SLM4(SLM4)
Recombinant Saccharomyces cerevisiae Protein SLM4(SLM4)
SKU:CSB-CF336424SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P38247
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSI NEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVA QIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG
Protein Names:Recommended name: Protein SLM4 Alternative name(s): EGO complex subunit 3 GSE complex subunit 1
Gene Names:Name:SLM4 Synonyms:EGO3, GSE1 Ordered Locus Names:YBR077C ORF Names:YBR0723
Expression Region:1-162
Sequence Info:full length protein
