Recombinant Saccharomyces cerevisiae Processing of GAS1 and ALP protein 2(PGA2)

CSB-CF346495SVG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P53903

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SEVAETWVDTWMAKLVNYDYKHFIRLVIIVGGYLLLRNIASRELAKKQLAAQVEKDKRDK EEKRSKDLIDKPDDAATAETTSFGWGKKTRRRVKRQQELFENALEEAKRRNQGLDPDSDA DIEELLEE

Protein Names:Recommended name: Processing of GAS1 and ALP protein 2

Gene Names:Name:PGA2 Ordered Locus Names:YNL149C ORF Names:N1774

Expression Region:2-129

Sequence Info:full length protein