Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

Recombinant Saccharomyces cerevisiae Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

SKU:CSB-CF339645SVG

Regular price €1.465,95 EUR
Regular price Sale price €1.465,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P36147

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASQPSVTAAALRSTATTLPLRSYSQPASLQDSSILTWSDFFKLRKQQRRINVGSSLFTAL LGCNVSWAYLSTMEIDPTQMLFGFDPLTVISAGIIASGALGYLLGPIVGSQVFKLSHNQQ LAQFNNKNKEFLKHIINNRVDASSQSFSNPVPDYYGEKIGSLKEYKQWLRDCHAYAKKAK EFL

Protein Names:Recommended name: Presequence translocated-associated motor subunit PAM17, mitochondrial

Gene Names:Name:PAM17 Synonyms:FMP18 Ordered Locus Names:YKR065C

Expression Region:15-197

Sequence Info:full length protein

View full details