Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P32897
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM23 Alternative name(s): Membrane import machinery protein MIM23 Mitochondrial protein import protein 3 Mitochondrial protein import protein MAS6
Gene Names:Name:TIM23 Synonyms:MAS6, MIM23, MPI3 Ordered Locus Names:YNR017W ORF Names:N3180
Expression Region:1-222
Sequence Info:full length protein