Gene Bio Systems
Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP23(TVP23)
Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP23(TVP23)
SKU:CSB-CF340036SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P38962
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV PGFENLSRLANIQSFFQRQ
Protein Names:Recommended name: Golgi apparatus membrane protein TVP23 Alternative name(s): TLG2 compartment vesicle protein of 23 kDa
Gene Names:Name:TVP23 Ordered Locus Names:YDR084C ORF Names:D4466
Expression Region:1-199
Sequence Info:full length protein
