Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Beta-1,6-glucan synthesis-associated protein KEG1(KEG1)

Recombinant Saccharomyces cerevisiae Beta-1,6-glucan synthesis-associated protein KEG1(KEG1)

SKU:CSB-CF331892SVG

Regular price €1.487,95 EUR
Regular price Sale price €1.487,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P43614

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGIKLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIME VIWLLRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQ AYCHWCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINR VVLLAYFPVLLTAYKKLLTK

Protein Names:Recommended name: Beta-1,6-glucan synthesis-associated protein KEG1 Alternative name(s): KRE6-binding ER protein responsible for glucan synthesis protein 1

Gene Names:Name:KEG1 Ordered Locus Names:YFR042W

Expression Region:1-200

Sequence Info:full length protein

View full details