Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial(AIM37)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial(AIM37)

SKU:CSB-CF412231STA

Regular price €1.522,95 EUR
Regular price Sale price €1.522,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Uniprot NO.:A6ZRY0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVNFYDDVDESKSHGEFPLIPVVLQNSSELSVRTIPTGNEIIESVHLTKWLRKYRNALAS QLDRYEKGWQSKIANFRLQVQHVINYSRKNIFNVDSENKHTVVPGSLIALGAFFAGSIAV NRSNWGAKRLIFGHKSSILEKLCTSLPSRILLPWVLAAATFKYWAPQTSQNLVNATENDL LPADFVKSYHNTWKRIYEEGYVAKKCDLKRQIDQTLQKNIRYAREQLYEKLEQA

Protein Names:Recommended name: Altered inheritance of mitochondria protein 37, mitochondrial

Gene Names:Name:AIM37 ORF Names:SCY_4691

Expression Region:1-234

Sequence Info:full length protein

View full details