Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)

SKU:CSB-CF459237SVP

Regular price €1.424,95 EUR
Regular price Sale price €1.424,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)

Uniprot NO.:B3LRL2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIEEKKELKKRRVLQMARFYGAAAFTLITMRLISRAIKVRKYVPSIFQQNYKLPPFSQRN EAMSALTYASAASIGTFSTLIFGFCWALDISTAREFVFKTREFMSLPQALETDTSMDEET SKLTKQLQDLLSSENNK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 11 Alternative name(s): Genetic interactor of prohibitins 8

Gene Names:Name:AIM11 Synonyms:GEP8 ORF Names:SCRG_04571

Expression Region:1-137

Sequence Info:full length protein

View full details