Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein(ACB1)

Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein(ACB1)

SKU:CSB-YP006519SVG

Regular price €1.122,95 EUR
Regular price Sale price €1.122,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P31787

Gene Names: ACB1

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS

Expression Region: 1-87aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 12.1 kDa

Alternative Name(s): Short name:ACBP

Relevance: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.

Reference: "Quantitative trait loci mapped to single-nucleotide resolution in yeast."Deutschbauer A.M., Davis R.W.Nat. Genet. 37:1333-1340(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details