Recombinant Rickettsia conorii Uncharacterized protein RC0045(RC0045)

CSB-CF838934RMS

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Uniprot NO.:Q92JM2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNCPLSLQIVNVSYIVNTNSCSWIAFNNSKYPIKTIKINIININILGKINHMVIFCDNNI VIILWKIMVVIISSIIHRTYIRRWISRRNNIRRKASHACKQPNNTTGC

Protein Names:Recommended name: Uncharacterized protein RC0045

Gene Names:Ordered Locus Names:RC0045

Expression Region:1-108

Sequence Info:full length protein