Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia bellii Putative Na(+)-H(+) antiporter nhaA homolog

Recombinant Rickettsia bellii Putative Na(+)-H(+) antiporter nhaA homolog

SKU:CSB-CF423760RIM

Regular price €1.455,95 EUR
Regular price Sale price €1.455,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia bellii (strain OSU 85-389)

Uniprot NO.:A8GYC5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVEAGIHGTLCGAIIALFIPVNIKGQINSSFHKLEKLIQPFVNYFILPLFVFMNSGVLLK DFSFRSVCSSLTFGIILGLFIGKQLGVMLFSYPCVKFNFCSLPSNTSWLKFYSIAILGGI GFTLSLFIGGITFEGGCPSNSMRVAVIIGSLLSALFGILVMRYCTKSK

Protein Names:Recommended name: Putative Na(+)/H(+) antiporter nhaA homolog

Gene Names:Name:nhaA Ordered Locus Names:A1I_07885

Expression Region:1-168

Sequence Info:full length protein

View full details