Gene Bio Systems
Recombinant Rickettsia bellii Putative Na(+)-H(+) antiporter nhaA homolog
Recombinant Rickettsia bellii Putative Na(+)-H(+) antiporter nhaA homolog
SKU:CSB-CF423760RIM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia bellii (strain OSU 85-389)
Uniprot NO.:A8GYC5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVEAGIHGTLCGAIIALFIPVNIKGQINSSFHKLEKLIQPFVNYFILPLFVFMNSGVLLK DFSFRSVCSSLTFGIILGLFIGKQLGVMLFSYPCVKFNFCSLPSNTSWLKFYSIAILGGI GFTLSLFIGGITFEGGCPSNSMRVAVIIGSLLSALFGILVMRYCTKSK
Protein Names:Recommended name: Putative Na(+)/H(+) antiporter nhaA homolog
Gene Names:Name:nhaA Ordered Locus Names:A1I_07885
Expression Region:1-168
Sequence Info:full length protein
