Gene Bio Systems
Recombinant Rickettsia bellii Probable intracellular septation protein A(RBE_0324)
Recombinant Rickettsia bellii Probable intracellular septation protein A(RBE_0324)
SKU:CSB-CF638437RAAI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rickettsia bellii (strain RML369-C)
Uniprot NO.:Q1RJQ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFKLLSEIGPVVAFFAGFFYGGGIQSATLYMLITSVICITLCYIIDKKVSRLSIISTAVL LVSGIITLISGDSMYIKIKPTILYVIFGIIFLTSGIKKNPFIKYALESIIRLKEESWITL SYRTATFFFFMAIVNEIVWRNFPDETWVKFKVFGVVPITFVFILLQLPLLLKNKLPDSKI
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:RBE_0324
Expression Region:1-180
Sequence Info:full length protein
