Gene Bio Systems
Recombinant Rickettsia akari Putative Na(+)-H(+) antiporter nhaA homolog
Recombinant Rickettsia akari Putative Na(+)-H(+) antiporter nhaA homolog
SKU:CSB-CF420596RIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia akari (strain Hartford)
Uniprot NO.:A8GQA2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVVHALIYIFFNYDKPGLIKGWAVPIATDTAFVLGIVSFFSRHISLELRTFIIGFSLIDD AFAPIILS
Protein Names:Recommended name: Putative Na(+)/H(+) antiporter nhaA homolog
Gene Names:Name:nhaA Ordered Locus Names:A1C_06770
Expression Region:1-68
Sequence Info:full length protein
