Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ricinus communis CASP-like protein RCOM_1504680 (RCOM_1504680)

Recombinant Ricinus communis CASP-like protein RCOM_1504680 (RCOM_1504680)

SKU:CSB-CF495604RMM

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ricinus communis (Castor bean)

Uniprot NO.:B9RA90

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENVEDKYNSPLKSQKLFIGAQICLRIVTIGATLAATWIMVTDKQSITFGDFVMVAKYNY SSAFKFFVLANVIACACSVVSLLFLCALGRYSSNPGHVFLLFLHDLLMMSLVLAGCSAAT AIGFLGKYGNTKSGWMPICDQFGQFCNRGTISMMLSYLSMVCLLILTVTSANKSRQIHV

Protein Names:Recommended name: CASP-like protein RCOM_1504680

Gene Names:ORF Names:RCOM_1504680

Expression Region:1-179

Sequence Info:full length protein

View full details