Gene Bio Systems
Recombinant Rhodococcus sp. UPF0060 membrane protein RHA1_ro06609(RHA1_ro06609)
Recombinant Rhodococcus sp. UPF0060 membrane protein RHA1_ro06609(RHA1_ro06609)
SKU:CSB-CF610421RLO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodococcus sp. (strain RHA1)
Uniprot NO.:Q0S254
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTVAKSVALFAVAALFEIGGAWLVWQGVREHRGWIWIGAGVAALGAYGFVATLQPDAHFG RILAAYGGVFVAGSLIWGMVADGFRPDRWDVSGALICLLGMAVIMYAPR
Protein Names:Recommended name: UPF0060 membrane protein RHA1_ro06609
Gene Names:Ordered Locus Names:RHA1_ro06609
Expression Region:1-109
Sequence Info:full length protein
