Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Uniprot NO.:Q3IZ47
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPAIESGLWALILTGVLGYLLGSIPFGIVITRALGLGDLRKIGSGNIGATNVLRTGNKPA ALATLLLDSGKGAIAVLIARAAVGEDAAQLAAFTSFLGHLFPVWLGFRGGKGVATFLGTL LALAWPVGLACCLTWLATAALGRISSLSALVAAASGVLWMILLGYGQMAALGAVLAVLIF IRHHANIRRILAGTEPRIGKK
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Ordered Locus Names:RHOS4_26190 ORF Names:RSP_1004
Expression Region:1-201
Sequence Info:full length protein