Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium sp. Uncharacterized protein y4lN (NGR_a02620)

Recombinant Rhizobium sp. Uncharacterized protein y4lN (NGR_a02620)

SKU:CSB-CF345092RKX

Regular price €1.466,95 EUR
Regular price Sale price €1.466,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium sp. (strain NGR234)

Uniprot NO.:P55554

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISEASSRPGFITAPADPVGEYPRASRRFESALLHIEVLSAMNIEKLLGGFANVAAILTP LVAVLAYSRFLWERRQKRLRLESYLREQKLFECTGQHSFLHLVATLGMFEADIMDASYRS KVISRNVAVDVAGEPVRIVLEYEPDDLEKELPKRPGRGQF

Protein Names:Recommended name: Uncharacterized protein y4lN

Gene Names:Ordered Locus Names:NGR_a02620 ORF Names:y4lN

Expression Region:1-160

Sequence Info:full length protein

View full details