Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium sp. Probable amino-acid ABC transporter permease protein y4tG (NGR_a01520)

Recombinant Rhizobium sp. Probable amino-acid ABC transporter permease protein y4tG (NGR_a01520)

SKU:CSB-CF345497RKX

Regular price €1.520,95 EUR
Regular price Sale price €1.520,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium sp. (strain NGR234)

Uniprot NO.:P55661

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLYGFTWDTGNGELAFAISILPMLLMGLITTLQAAFLGFFVACVLGMVFAVLRGMRTRWV AWPAAVLIEFIRDTPLIAQLFFLYYVLPEYGIIFPAFLTGALALGIQYSAYISEVYRGGI QAVDHGQREAAKSLDLPPARTFTHVILPQAIPRVIPALGNYLVSIMKDVPVLSVVTIVEM LNAAKIIGDQTFNYLVPLSMVGGIYLILTIVASALVRIVDVNLPKRGVPLR

Protein Names:Recommended name: Probable amino-acid ABC transporter permease protein y4tG

Gene Names:Ordered Locus Names:NGR_a01520 ORF Names:y4tG

Expression Region:1-231

Sequence Info:full length protein

View full details