Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti Aquaporin Z 1(aqpZ1)

Recombinant Rhizobium meliloti Aquaporin Z 1(aqpZ1)

SKU:CSB-CF821843RKU

Regular price €1.508,95 EUR
Regular price Sale price €1.508,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:Q92NM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFRKLSVEFLGTFWLVLGGCGSAVLAAAFPEVGIGLLGVSFAFGLTVLTMAYAVGGISGG HFNPAVSVGLAVAGRMPPASLVGYILAQVTGAIAAAAVLYVIASGKADFQLGGFAANGYG EHSPGGYSLTAALVTEVVMTAFFLLIILGSTHSRVPVGFAPIAIGLGLTLIHLVSIPVTN TSVNPARSTGQALFVGDWAISQLWLFWVAPLIGAVIAGIVWKIVGDDS

Protein Names:Recommended name: Aquaporin Z 1

Gene Names:Name:aqpZ1 Ordered Locus Names:R02172 ORF Names:SMc01870

Expression Region:1-228

Sequence Info:full length protein

View full details