Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium leguminosarum bv. viciae UPF0314 protein RL4541(RL4541)

Recombinant Rhizobium leguminosarum bv. viciae UPF0314 protein RL4541(RL4541)

SKU:CSB-CF629824RKS

Regular price €1.484,95 EUR
Regular price Sale price €1.484,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. viciae (strain 3841)

Uniprot NO.:Q1MAL3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAVDVESRVRHQNFWFVACFAVLVIQIAVEYMMGRVPICACGYVKLWEGGVNTSGNSQH LSDWYTPSHIIHGFLFYGLAHLILRRKPLAAKLLLALVIESGWELLENSPLIIDRYRTAT IALDYYGDSILNSAMDTVFMCVGFFFARRAPVALTVAIATFFEIFTGYIIRDNLTLNVVM LIWPVEAIKVWQGGV

Protein Names:Recommended name: UPF0314 protein RL4541

Gene Names:Ordered Locus Names:RL4541

Expression Region:1-195

Sequence Info:full length protein

View full details