Gene Bio Systems
Recombinant Rat Vesicle transport protein SFT2A(Sft2d1)
Recombinant Rat Vesicle transport protein SFT2A(Sft2d1)
SKU:CSB-CF719455RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q5U3Y5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSILGTGLLWLPNG VKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRK KGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSILS
Protein Names:Recommended name: Vesicle transport protein SFT2A Alternative name(s): SFT2 domain-containing protein 1
Gene Names:Name:Sft2d1
Expression Region:1-159
Sequence Info:full length protein
