Gene Bio Systems
Recombinant Rat Transmembrane protein 14C(Tmem14c)
Recombinant Rat Transmembrane protein 14C(Tmem14c)
SKU:CSB-CF023722RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q924P2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QKDSGPLVPLHYYGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPR NVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAPGVAKIQEITTMP
Protein Names:Recommended name: Transmembrane protein 14C Alternative name(s): p11
Gene Names:Name:Tmem14c Synonyms:Cdtw1
Expression Region:2-115
Sequence Info:full length protein
