Gene Bio Systems
Recombinant Rat T-cell surface glycoprotein CD8 alpha chain(Cd8a)
Recombinant Rat T-cell surface glycoprotein CD8 alpha chain(Cd8a)
SKU:CSB-CF004966RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P07725
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIYIWAPLAGICAVLLLSLVITLICCHRNRRRVCKCPRPLVKPRPSEKFV
Protein Names:Recommended name: T-cell surface glycoprotein CD8 alpha chain Alternative name(s): CD8 antigen 32 kDa chain OX-8 membrane antigen CD_antigen= CD8a
Gene Names:Name:Cd8a
Expression Region:27-236
Sequence Info:full length protein
