Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat T-cell surface glycoprotein CD5(Cd5)

Recombinant Rat T-cell surface glycoprotein CD5(Cd5)

SKU:CSB-CF004942RA

Regular price €1.748,95 EUR
Regular price Sale price €1.748,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P51882

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QSGRGFVGAQVMLSGSNSKCQGLVEVQMNGMKTVCSSSWRLSQDLWKNANEASTVCQQLGCGNPLALGHLTLWNRPKNQILCQGPPWSFSNCSTSSLGQCLPLSLVCLEPQKTTPLPTTTLPTTMPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSRGGTILYKAKARPVDLGNLICKSLQCGSFLTHLSRIETAGTPAPAELRDPRPLPIRWEAQNGSCTSLQQCFQKTTVQEGSQALAVVCSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWAALCDSSAARGPGRWEELCQEQQCGNLISFHVMDADRTSPGVLCTQEKLSQCYQLQKKTHCKRVFITCKDPNPVGLAPGTVASIILTLVLLVVLMVMCGPLIYKKLVKKFRQKKQRQWIGPTGVNQSMSFHRSHTATVRSQVENPAASHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPDNSSDSDYDLQVAQRL

Protein Names:Recommended name: T-cell surface glycoprotein CD5 Alternative name(s): CD_antigen= CD5

Gene Names:Name:Cd5

Expression Region:24-491

Sequence Info:full length protein

View full details