Gene Bio Systems
Recombinant Rat Syndecan-4(Sdc4)
Recombinant Rat Syndecan-4(Sdc4)
SKU:CSB-CF020891RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P34901
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGLEQDSDFELSGSGDLDDTEEPRTFPEVISPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRVPSDVGDDDVSNKVSMSSTSQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA
Protein Names:Recommended name: Syndecan-4 Short name= SYND4 Alternative name(s): Ryudocan core protein
Gene Names:Name:Sdc4 Synonyms:Synd4
Expression Region:24-202
Sequence Info:full length protein
