Gene Bio Systems
Recombinant Rat Synaptotagmin-5(Syt5)
Recombinant Rat Synaptotagmin-5(Syt5)
SKU:CSB-CF023041RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P47861
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFPEPPTPGSPAPETPPDSSRIRQGAVPAWVLATILLGSGLLVFSSCFCLYRKRCRRRMGKKSQAQAQVHLQEVKELGRSYIDKVQPEIEELDPSPSMPGQQVLDKHQLGRLQYSLDYDFQTGQLLVGILQAEGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGTAVGGAGLRHWADMLANPRRPIAQWHSLRPPDRARPIPAP
Protein Names:Recommended name: Synaptotagmin-5 Alternative name(s): Synaptotagmin IX Synaptotagmin V Short name= SytV
Gene Names:Name:Syt5
Expression Region:1-386
Sequence Info:full length protein
