Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Rhomboid-related protein 1(Rhbdl1)

Recombinant Rat Rhomboid-related protein 1(Rhbdl1)

SKU:CSB-CF019671RA

Regular price €1.447,95 EUR
Regular price Sale price €1.447,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O88779

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGS GGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQP SFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFL

Protein Names:Recommended name: Rhomboid-related protein 1 Short name= RRP EC= 3.4.21.105 Alternative name(s): Rhomboid-like protein 1

Gene Names:Name:Rhbdl1 Synonyms:Rhbdl

Expression Region:1-164

Sequence Info:Full length protein

View full details