Gene Bio Systems
Recombinant Rat Proheparin-binding EGF-like growth factor(Hbegf)
Recombinant Rat Proheparin-binding EGF-like growth factor(Hbegf)
SKU:CSB-CF010154RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q06175
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH
Protein Names:Recommended name: Proheparin-binding EGF-like growth factor Cleaved into the following chain: 1. Heparin-binding EGF-like growth factor Short name= 2. HB-EGF Short name= 3. HBEGF
Gene Names:Name:Hbegf Synonyms:Dtr, Hegfl
Expression Region:24-208
Sequence Info:full length protein
