Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat OX-2 membrane glycoprotein(Cd200)

Recombinant Rat OX-2 membrane glycoprotein(Cd200)

SKU:CSB-CF004895RA

Regular price €1.529,95 EUR
Regular price Sale price €1.529,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P04218

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QVEVVTQDERKLLHTTASLRCSLKTTQEPLIVTWQKKKAVGPENMVTYSKAHGVVIQPTYKDRINITELGLLNTSITFWNTTLDDEGCYMCLFNMFGSGKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGSGIENSTESHSHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK

Protein Names:Recommended name: OX-2 membrane glycoprotein Alternative name(s): MRC OX-2 antigen CD_antigen= CD200

Gene Names:Name:Cd200 Synonyms:Mox2

Expression Region:31-278

Sequence Info:full length protein

View full details