Gene Bio Systems
Recombinant Rat Membrane magnesium transporter 1(Mmgt1)
Recombinant Rat Membrane magnesium transporter 1(Mmgt1)
SKU:CSB-CF014655RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:B5DF51
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDATNSSNLDALSSNTSLKLRKFDSLRR
Protein Names:Recommended name: Membrane magnesium transporter 1 Alternative name(s): Transmembrane protein 32
Gene Names:Name:Mmgt1 Synonyms:Tmem32
Expression Region:21-131
Sequence Info:full length protein
