Gene Bio Systems
Recombinant Rat Membrane-associated progesterone receptor component 1(Pgrmc1)
Recombinant Rat Membrane-associated progesterone receptor component 1(Pgrmc1)
SKU:CSB-CF017876RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P70580
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDEAARKSD
Protein Names:Recommended name: Membrane-associated progesterone receptor component 1 Alternative name(s): 25-DX Acidic 25 kDa protein Ventral midline antigen Short name= VEMA
Gene Names:Name:Pgrmc1 Synonyms:25dx, Lewi, Pgrmc
Expression Region:2-195
Sequence Info:full length protein
