Gene Bio Systems
Recombinant Rat Matrilysin(Mmp7)
Recombinant Rat Matrilysin(Mmp7)
SKU:CSB-EP014677RA
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P50280
Gene Names: Mmp7
Organism: Rattus norvegicus (Rat)
AA Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Expression Region: 98-267aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 45.9 kDa
Alternative Name(s): Matrin;Matrix metalloproteinase-7 ;MMP-7Pump-1 proteaseUterine metalloproteinase
Relevance: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase .
Reference: Characterization of rat uterine matrilysin and its cDNA. Relationship to human pump-1 and activation of procollagenases.Abramson S.R., Conner G.E., Nagase H., Neuhaus I., Woessner J.F.J. Biol. Chem. 270:16016-16022(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
