Gene Bio Systems
Recombinant Rat Kit ligand(Kitlg)
Recombinant Rat Kit ligand(Kitlg)
SKU:CSB-CF012376RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P21581
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
Protein Names:Recommended name: Kit ligand Alternative name(s): Hematopoietic growth factor KL Mast cell growth factor Short name= MGF Stem cell factor Short name= SCF c-Kit ligand Cleaved into the following chain: 1. Soluble KIT ligand Short name= 2. sKITLG
Gene Names:Name:Kitlg Synonyms:Kitl, Mgf
Expression Region:26-273
Sequence Info:full length protein
