Recombinant Rat Glutathione S-transferase alpha-1(Gsta1)

Recombinant Rat Glutathione S-transferase alpha-1(Gsta1)

CSB-EP009970RA
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P00502

Gene Names: Gsta1

Organism: Rattus norvegicus (Rat)

AA Sequence: SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF

Expression Region: 2-222aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41.5 kDa

Alternative Name(s): GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1 ;GST Ya1;Ligandin

Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Reference: Localization of the C-terminus of rat glutathione S-transferase A1-1 crystal structure of mutants W21F and W21F/F220Y.Adman E.T., Le Trong I., Stenkamp R.E., Nieslanik B.S., Dietze E.C., Tai G., Ibarra C., Atkins W.M.3.0.CO;2-%23>Proteins 42:192-200(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share