Recombinant Rat Frataxin, mitochondrial(Fxn)

Recombinant Rat Frataxin, mitochondrial(Fxn)

CSB-EP009086RAe1
Regular price
€632,95 EUR
Sale price
€632,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Tags & Cell Markers

Target / Protein: Fxn

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: D3ZYW7

AA Sequence: LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Tag info: NO-tagged

Expression Region: 41-208aa

Protein length: Full Length of Mature Protein

MW: 18.6 kDa

Alternative Name(s):

Relevance: Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1

Reference: "Frataxin acts as an iron chaperone protein to modulate mitochondrial aconitase activity." Bulteau A.L., O'Neill H.A., Kennedy M.C., Ikeda-Saito M., Isaya G., Szweda L.I. Science 305:242-245(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share