Gene Bio Systems
Recombinant Rat Fetuin-B(Fetub)
Recombinant Rat Fetuin-B(Fetub)
SKU:CSB-YP868762RA
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cardiovascular
Uniprot ID: Q9QX79
Gene Names: Fetub
Organism: Rattus norvegicus (Rat)
AA Sequence: RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP
Expression Region: 19-378aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 41.7 kDa
Alternative Name(s): Fetuin-like protein IRL685
Relevance: Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening
Reference: "Fetuin-B, a second member of the fetuin family in mammals."Olivier E., Soury E., Ruminy P., Husson A., Parmentier F., Daveau M., Salier J.-P.Biochem. J. 350:589-597(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
