Recombinant Rabbit IL-17A protein(Il17a)

SKU: CSB-EP011597RB

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: G1SLF2

Gene Names: IL17A

Organism: Oryctolagus cuniculus (Rabbit)

AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Expression Region: 21-153aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 42.3 kDa

Alternative Name(s):

Relevance:

Reference: "A high-resolution map of human evolutionary constraint using 29 mammals."Lindblad-Toh K., Garber M., Zuk O., Lin M.F., Parker B.J., Washietl S., Kheradpour P., Ernst J., Jordan G., Mauceli E., Ward L.D., Lowe C.B., Holloway A.K., Clamp M., Gnerre S., Alfoldi J., Beal K., Chang J. Kellis M.Nature 478:476-482(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.