Skip to product information
1 of 1

GeneBio Systems

Recombinant Rabbit B (0,+)-type amino acid transporter 1 (SLC7A9), partial

Recombinant Rabbit B (0,+)-type amino acid transporter 1 (SLC7A9), partial

SKU:Q9N1R6

Regular price €667,95 EUR
Regular price Sale price €667,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Metabolism

Uniprot ID: Q9N1R6

Gene Names: SLC7A9

Alternative Name(s): 4F2-LC6;Glycoprotein-associated amino acid transporter b0,+AT1;Solute carrier family 7 member 9

Abbreviation: Recombinant Rabbit SLC7A9 protein, partial

Organism: Oryctolagus cuniculus (Rabbit)

Source: Yeast

Expression Region: 451-487aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: YFLFVYYKFEWAQKISKPITMHLQMLMEVVPPEPDPK

MW: 6.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Mediates the electrogenic exchange between cationic amino acids and neutral amino acids, with a stoichiometry of 1: 1 . Has system b(0,+)-like activity with high affinity for extracellular cationic amino acids and L-cystine and lower affinity for intracellular neutral amino acids . Substrate exchange is driven by high concentration of intracellular neutral amino acids and the intracellular reduction of L-cystine to L-cysteine . Required for reabsorption of L-cystine and dibasic amino acids across the brush border membrane in renal proximal tubules.

Reference:

Function:

View full details