Gene Bio Systems
Recombinant Rabbit Anion exchange transporter(SLC26A7)
Recombinant Rabbit Anion exchange transporter(SLC26A7)
SKU:CSB-CF816824RB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryctolagus cuniculus (Rabbit)
Uniprot NO.:Q8HY59
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LFSFKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPRGIPPPRAP PMNILSAVITEAFGVALVGYAASLALAQGSAKKFKYSVDDNQEFLAHGLSNVISSFLFCI PSAAAMGR
Protein Names:Recommended name: Anion exchange transporter Alternative name(s): Solute carrier family 26 member 7
Gene Names:Name:SLC26A7
Expression Region:1-128
Sequence Info:full length protein
