Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrus pyrifolia Chlorophyll a-b binding protein 1A, chloroplastic

Recombinant Pyrus pyrifolia Chlorophyll a-b binding protein 1A, chloroplastic

SKU:CSB-CF335010FIB

Regular price €1.516,95 EUR
Regular price Sale price €1.516,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pyrus pyrifolia (Chinese pear) (Pyrus serotina)

Uniprot NO.:P24006

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKATGRKSVAASIDSPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLI HAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVK EIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 1A, chloroplastic Alternative name(s): LHCII type II CAB-1A Short name= LHCP

Gene Names:

Expression Region:46-278

Sequence Info:full length protein

View full details