Gene Bio Systems
Recombinant Pyrococcus horikoshii UPF0290 protein PH0343 (PH0343)
Recombinant Pyrococcus horikoshii UPF0290 protein PH0343 (PH0343)
SKU:CSB-CF527580FHX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Uniprot NO.:O58081
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKMNQLLEAFWYILPAYFANSSPVVLGGGTPIDFGKKWRDGRRILGDGKTWRGFFGGLIV GTIIGIVQYFLLPEYYGSLGIAIELAFLLSLGTLVGDLIGSFIKRRLNMPRGYPAVGLDQ WGFLIAALCFAYPVKTIPTGEVLFLLVITPLIHWGANIFAYKMGWKKVPW
Protein Names:Recommended name: UPF0290 protein PH0343
Gene Names:Ordered Locus Names:PH0343
Expression Region:1-170
Sequence Info:full length protein
