Gene Bio Systems
Recombinant Pyrenophora tritici-repentis Vacuolar ATPase assembly integral membrane protein VMA21(vma21)
Recombinant Pyrenophora tritici-repentis Vacuolar ATPase assembly integral membrane protein VMA21(vma21)
SKU:CSB-CF025866FHT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis)
Uniprot NO.:B2WDD8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTRRIVTSEKSTLDYDGKGAPEPSNTSPAVPSSVIWKLMSFTFAMITLPIGTYFFTVNW VFQGNATYAGGLAALMANVVLIAYVIMAFRDDQEEMREEAEKSKKKL
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:vma21 ORF Names:PTRG_07997
Expression Region:1-107
Sequence Info:full length protein
