Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative membrane protein mmpS2(mmpS2)

Recombinant Putative membrane protein mmpS2(mmpS2)

SKU:CSB-CF353321MVH

Regular price €1.419,95 EUR
Regular price Sale price €1.419,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium bovis

Uniprot NO.:P65377

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPDFDVPLFNPKRVT YEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAVSVNLMAQSNADVISCRII VNGAVKDERSETSPRALTSCQVSSG

Protein Names:Recommended name: Putative membrane protein mmpS2

Gene Names:Name:mmpS2 Ordered Locus Names:Mb0518

Expression Region:1-145

Sequence Info:full length protein

View full details