Gene Bio Systems
Recombinant Putative membrane protein mmpS1(mmpS1)
Recombinant Putative membrane protein mmpS1(mmpS1)
SKU:CSB-CF363718MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P0A5K0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVF GPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNE VIREERIVNAYHAHTSCLVKSA
Protein Names:Recommended name: Putative membrane protein mmpS1
Gene Names:Name:mmpS1 Ordered Locus Names:Rv0403c, MT0415 ORF Names:MTCY04D9.16c
Expression Region:1-142
Sequence Info:full length protein
