Gene Bio Systems
Recombinant Putative DNA utilization protein HofN(hofN)
Recombinant Putative DNA utilization protein HofN(hofN)
SKU:CSB-CF353755SZB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella flexneri
Uniprot NO.:P64635
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPPINFLPWRQQRRTAFLRFWLLMFVAPLLLAVGITLILRLTGSAEARIDAVLLQAEQQ LARSLQITKPRLLEQQQLREQRSQRQRQRQFTRDWQSALEALAALLPEHAWLTTISWQQG TLEIKGLTTSITALNALETSLRQDASFHLNQRGATQQDAQGRWQFEYQLTRKVSDEHVL
Protein Names:Recommended name: Putative DNA utilization protein HofN
Gene Names:Name:hofN Ordered Locus Names:SF3412, S4350
Expression Region:1-179
Sequence Info:full length protein
