Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative amino-acid transporter Rv1986-MT2040 (Rv1986, MT2040)

Recombinant Putative amino-acid transporter Rv1986-MT2040 (Rv1986, MT2040)

SKU:CSB-CF353216MVZ

Regular price €1.486,95 EUR
Regular price Sale price €1.486,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64903

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSPLVVGFLACFTLIAAIGAQNAFVLRQGIQREHVLPVVALCTVSDIVLIAAGIAGFGA LIGAHPRALNVVKFGGAAFLIGYGLLAARRAWRPVALIPSGATPVRLAEVLVTCAAFTFL NPHVYLDTVVLLGALANEHSDQRWLFGLGAVTASAVWFATLGFGAGRLRGLFTNPGSWRI LDGLIAVMMVALGISLTVT

Protein Names:Recommended name: Putative amino-acid transporter Rv1986/MT2040

Gene Names:Ordered Locus Names:Rv1986, MT2040 ORF Names:MTCY39.33c

Expression Region:1-199

Sequence Info:full length protein

View full details