Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pteropus scapulatus NADH-ubiquinone oxidoreductase chain 6(MT-ND6)

Recombinant Pteropus scapulatus NADH-ubiquinone oxidoreductase chain 6(MT-ND6)

SKU:CSB-CF887883PMAF-GB

Regular price €1.463,95 EUR
Regular price Sale price €1.463,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pteropus scapulatus (Little red flying fox)

Uniprot NO.:Q9G3S5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMTYIVFILSTVFVVGFVGFSSKPSPVYGGVGLIVSGGVGCGIIMNFSGSFLGLMVFLIY LGGMMVVFGYTAAMATELYPEVWVSNKVVFGAFVFGLFMEMLLVLYVLKEGSVGIAFEFS NLGDWVVYGVEDSGYFSKEAVGISSLYSYGMWLVVVTGWSLFIAVVVVMEVTRGG

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6

Gene Names:Name:MT-ND6 Synonyms:MTND6, NADH6, ND6

Expression Region:1-175

Sequence Info:full length protein

View full details