Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas syringae pv. tomato UPF0060 membrane protein PSPTO_1628(PSPTO_1628)

Recombinant Pseudomonas syringae pv. tomato UPF0060 membrane protein PSPTO_1628(PSPTO_1628)

SKU:CSB-CF801520FGP

Regular price €1.397,95 EUR
Regular price Sale price €1.397,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. tomato (strain DC3000)

Uniprot NO.:Q886F1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNYLWFFLAALFEIAGCYAFWLWLRQGKSALWVIPALISLTLFALLLTRVEAAYAGRAY AAYGGIYIVASIAWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAP

Protein Names:Recommended name: UPF0060 membrane protein PSPTO_1628

Gene Names:Ordered Locus Names:PSPTO_1628

Expression Region:1-110

Sequence Info:full length protein

View full details