Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas putida Cytochrome o ubiquinol oxidase protein CyoD(cyoD)

Recombinant Pseudomonas putida Cytochrome o ubiquinol oxidase protein CyoD(cyoD)

SKU:CSB-CF896271FFZ

Regular price €1.239,95 EUR
Regular price Sale price €1.239,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas putida (Arthrobacter siderocapsulatus)

Uniprot NO.:Q9WWR4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANAHDTHHEGNHGSVKSYMIGFILSIILTAIPFGLAMSPSLPKNLTVLIIVAMAVIQVV VHLVYFLHMDRSKEQRNNVWTFLFTTLVIALLVGLSLWIMFSIHFEMLAK

Protein Names:Recommended name: Cytochrome o ubiquinol oxidase protein CyoD Alternative name(s): Cytochrome o ubiquinol oxidase subunit IV

Gene Names:Name:cyoD

Expression Region:1-110

Sequence Info:full length protein

View full details