Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas fluorescens UPF0114 protein PFLU_5318 (PFLU_5318)

Recombinant Pseudomonas fluorescens UPF0114 protein PFLU_5318 (PFLU_5318)

SKU:CSB-CF500949FFU

Regular price €1.444,95 EUR
Regular price Sale price €1.444,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas fluorescens (strain SBW25)

Uniprot NO.:C3K2C1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERFIENAMYASRWLLAPIYFGLSLGLLALALKFFQEVIHLLPSVFSMAESELILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDDNKEKLNWLGTMDSSSLKMKVAASIVAISSIH LLRIFMDAKNVDPQHLMWYVIIHMTFVVSAFAMGYLDKVTKH

Protein Names:Recommended name: UPF0114 protein PFLU_5318

Gene Names:Ordered Locus Names:PFLU_5318

Expression Region:1-162

Sequence Info:full length protein

View full details